PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10008338m
Common NameEUTSA_v10008338mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family GATA
Protein Properties Length: 296aa    MW: 33023 Da    PI: 8.59
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10008338mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA64.11.6e-20212246135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C++C ttkTp+WR+gp+g+ktLCnaCG+++r+ +l
  Thhalv10008338m 212 CTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRL 246
                      *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577162.66E-15205268No hitNo description
SMARTSM004017.3E-20206256IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.2E-15210243IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.084210242IPR000679Zinc finger, GATA-type
CDDcd002021.66E-16211260No hitNo description
PfamPF003202.5E-18212246IPR000679Zinc finger, GATA-type
PROSITE patternPS003440212237IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MNWLPEEDLK GFLDDFFDDF LPEDIDTTNG EGDWDAKFQD LEPPPMNMFP SLPSELTSCA  60
ISNGGRVGTQ KTVPILKQST SSGALSGINS ALHQSSSPPD IKVSKLFQSS SPVSVLESSD  120
GSFSPQNSRS QRLTFTVKGM RSKRKRPTTP RFRYLYPFES SKPEKLTPGE SESETCYSFE  180
RHAKKKRKIL PTSHTVSSIA EASNSDGMVR KCTHCETTKT PQWREGPNGP KTLCNACGVR  240
FRSGRLVPEY RPASSPTFIP SVHSNSHRKI IEMRRTDQGQ FDTSMELNDK REVQF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006417739.10.0hypothetical protein EUTSA_v10008338mg
RefseqXP_006417740.10.0hypothetical protein EUTSA_v10008338mg
RefseqXP_006417741.10.0hypothetical protein EUTSA_v10008338mg
SwissprotQ6DBP81e-144GAT11_ARATH; GATA transcription factor 11
TrEMBLV4L1D50.0V4L1D5_EUTSA; Uncharacterized protein
STRINGBra018665.1-P1e-148(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-127GATA transcription factor 11